PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G002400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family B3
Protein Properties Length: 290aa    MW: 31181.3 Da    PI: 9.3246
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G002400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.42e-161194186
                        EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86
                        ffkvl+ + +++s+ l+lp kfa+  +g +++    tl+d++grsW+v l +r++s+ ++ ++GW++Fv+  gL +g f+vF +  
  Brast10G002400.1.p 11 FFKVLL-PGTFESC-LWLPPKFAAGLEGCPPGIAAATLRDPTGRSWRVDLDHRGGSSVCFAGEGWRRFVSGCGLSAGHFLVFDHLA 94
                        788883.3455555.********99988888889****************99999999************************9764 PP

2B340.84e-131972751487
                         T-EE--HHH.HTT---..--SEEEEEETTS....-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEE...E-SS CS
                  B3  14 grlvlpkkfaeehggkkeesktltledesg....rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFk...ldgr 87 
                         ++l ++  f+e+ g  + +  +l++ d+ +    r+Wev +  +  +++ ++ +GW +F+k+n+L++ D +vF+   ++g+
  Brast10G002400.1.p 197 QCLDVSMGFCESLGWTTSRAAELVVVDTGNggerRRWEVGV--NVAGKGGMILRGWAKFAKDNKLRVADACVFRpvhVVGT 275
                         557888999*9998888888899999966669*********..55555555667********************5532344 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100178.95E-169105No hitNo description
PROSITE profilePS5086310.9419107IPR003340B3 DNA binding domain
SuperFamilySSF1019362.35E-159109IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-169109IPR015300DNA-binding pseudobarrel domain
PfamPF023629.8E-141194IPR003340B3 DNA binding domain
SMARTSM010195.8E-1111107IPR003340B3 DNA binding domain
SMARTSM010190.11186288IPR003340B3 DNA binding domain
PfamPF023624.7E-10197284IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-11197283IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.04E-10198276IPR015300DNA-binding pseudobarrel domain
CDDcd100171.01E-7199268No hitNo description
PROSITE profilePS508639.996218288IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MAASLGGRRK FFKVLLPGTF ESCLWLPPKF AAGLEGCPPG IAAATLRDPT GRSWRVDLDH  60
RGGSSVCFAG EGWRRFVSGC GLSAGHFLVF DHLAGGLDFA VDPFDASGCS LDISTHHPAK  120
LKEDDDDTAS RCHGDTESGN GKKQSGRSRS PAGTKRKRKR SPVATSCGGG RRARREDDED  180
GETVVLRRRI GTPHELQCLD VSMGFCESLG WTTSRAAELV VVDTGNGGER RRWEVGVNVA  240
GKGGMILRGW AKFAKDNKLR VADACVFRPV HVVGTGDRFL QVQFLRGQP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ2348382e-99FJ234838.1 Brachypodium sylvaticum clone BAC 37D5 hardness locus region genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014757719.11e-78PREDICTED: B3 domain-containing protein At3g18960-like
TrEMBLI1IG051e-156I1IG05_BRADI; Uncharacterized protein
STRINGBRADI4G00380.11e-156(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP168021012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.11e-11B3 family protein